PEMT Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59580

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PEMT Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PEMT(phosphatidylethanolamine N-methyltransferase) The peptide sequence was selected from the C terminal of PEMT. Peptide sequence GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PEMT Antibody - BSA Free

Western Blot: PEMT Antibody [NBP1-59580]

Western Blot: PEMT Antibody [NBP1-59580]

Western Blot: PEMT Antibody [NBP1-59580] - 721_B cell lysate, concentration 0.2-1 ug/ml.
Western Blot: PEMT Antibody [NBP1-59580]

Western Blot: PEMT Antibody [NBP1-59580]

Western Blot: PEMT Antibody [NBP1-59580] - Rat liver lysate
Western Blot: PEMT Antibody [NBP1-59580]

Western Blot: PEMT Antibody [NBP1-59580]

Western Blot: PEMT Antibody [NBP1-59580] - Rat liver lysate.

Applications for PEMT Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PEMT

PEMT is an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene encodes PEMT protein is within the Smith-Magenis syndrome region on chromosome 17. This gene encodes an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene is within the Smith-Magenis syndrome region on chromosome 17. Alternate splicing of this gene results in three transcript variants encoding two different isoforms.

Alternate Names

EC 2.1.1.17, PEMPTMGC2483, PEMT2PEAMT, phosphatidylethanolamine N-methyltransferase, PNMT

Gene Symbol

PEMT

UniProt

Q9BW86 (Human)

Additional PEMT Products

Product Documents for PEMT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PEMT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PEMT Antibody - BSA Free

Customer Reviews for PEMT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PEMT Antibody - BSA Free and earn rewards!

Have you used PEMT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies