Pet1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85459

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Pet1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human Pet1. Peptide sequence: PLSPAVQKGSGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Pet1 Antibody - BSA Free

Western Blot: Pet1 Antibody [NBP2-85459]

Western Blot: Pet1 Antibody [NBP2-85459]

Western Blot: Pet1 Antibody [NBP2-85459] - WB Suggested Anti-FEV Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Hela cell lysate

Applications for Pet1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Pet1

Pet1 belongs to the ETS transcription factor family. ETS family members have a highly conserved 85-amino acid ETS domain that binds purine-rich DNA sequences. The alanine-rich C-terminus of this gene indicates that it may act as a transcription repressor. This gene is exclusively expressed in neurons of the central serotonin (5-HT) system, a system implicated in the pathogeny of such psychiatric diseases as depression, anxiety, and eating disorders. In some types of Ewing tumors, this gene is fused to the Ewing sarcoma (EWS) gene following chromosome translocations.

Alternate Names

FEV (ETS oncogene family), FEV (fifth Ewing variant), Fifth Ewing variant protein, HSRNAFEV, PC12 ETS domain-containing transcription factor 1, PC12 ETS factor 1, PET1, PET-1, protein FEV

Gene Symbol

FEV

Additional Pet1 Products

Product Documents for Pet1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Pet1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Pet1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Pet1 Antibody - BSA Free and earn rewards!

Have you used Pet1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies