PEX1 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-80577PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
View all PEX1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PEX1.

Source: E. coli

Amino Acid Sequence: SAPSSMTQDLPGVPGKDQLFSQPPVLRTASQEGCQELTQEQRDQLRADISIIKGRYRSQSGEDESMNQPGPIKTRLAISQSHLMTALGHTRPSISEDDWKNFAELYESFQNPKRRKNQSGTMFRPG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80577.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-80577PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PEX1

PEX1, also known as Peroxisome biogenesis factor 1, is a 1,283 amino acid protein that is 143 kDa, cytoplasmic but is often anchored to a peroxisomal membrane where it forms a heteromeric complex and plays a role in the import of proteins into peroxisomes and peroxisome biogenesis. This protein is currently being studied for research on the following disease and disorders: Zellweger syndrome, peroxisomal biogenesis disorder, peroxisome biogenesis disorders, peroxisome biogenesis factor, Infantile Refsum Disease, Zellweger syndrome-1, refsum disease, neonatal adrenoleukodystrophy, adrenoleukodystrophy, peroxisome biogenesis disorders, Zellweger syndrome spectrum, peroxisome biogenesis disorders (pbd), Werdnig-Hoffmann disease, rhizomelic chondrodysplasia punctate, chondrodysplasia punctate, mulibrey nanism, chondrodysplasia, osteoporosis, hepatocellular carcinoma, and lung carcinoma. PEX1protein involvement has been observed with relation to HIST1H2BC, HIST1H2BE, HIST1H2BF, HIST1H2BG, and HIST1H2BI in peroxisome pathways.

Alternate Names

Peroxin-1, peroxisomal biogenesis factor 1, Peroxisome biogenesis disorder protein 1, peroxisome biogenesis factor 1, Zellweger syndrome, Zellweger syndrome 1, ZWS, ZWS1

Gene Symbol

PEX1

Additional PEX1 Products

Product Documents for PEX1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PEX1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for PEX1 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review PEX1 Recombinant Protein Antigen and earn rewards!

Have you used PEX1 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes