PHOX2B Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10477

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PHOX2B Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat PHOX2B (XP_001077800). Peptide sequence MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTT

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PHOX2B Antibody - BSA Free

Western Blot: PHOX2B Antibody [NBP3-10477]

Western Blot: PHOX2B Antibody [NBP3-10477]

Western Blot: PHOX2B Antibody [NBP3-10477] - Western blot analysis of PHOX2B in Rat Stomach lysates. Antibody dilution at 1.0ug/ml

Applications for PHOX2B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PHOX2B

The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription factor involved in the development of several major noradrenergic neuron populations and the determination of neurotransmitter phenotype. The gene product is linked to enhancement of second messenger-mediated activation of the dopamine beta-hydroylase, c-fos promoters and several enhancers, including cyclic amp-response element and serum-response element. (provided by RefSeq)

Long Name

Paired-like Homeobox 2b

Alternate Names

NBPhox, PMX2B

Gene Symbol

PHOX2B

Additional PHOX2B Products

Product Documents for PHOX2B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PHOX2B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PHOX2B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PHOX2B Antibody - BSA Free and earn rewards!

Have you used PHOX2B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies