PICK1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35510

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 300-400 of human PICK1 (NP_036539.1).

Sequence:
YLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PICK1 Antibody - BSA Free

PICK1 Antibody

Western Blot: PICK1 Antibody [NBP3-35510] -

Western Blot: PICK1 Antibody [NBP3-35510] - Western blot analysis of various lysates using PICK1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

Applications for PICK1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PICK1

PSD-95/DLG/ZO-1 (PDZ) domain-containing proteins play a central role in synaptic membrane protein localization. The protein interacting with protein kinase C (PICK 1) is a synaptic PDZ domain protein that also contains a coiled-coil and acidic domain. Studies indicate that PICK 1 functions as a targeting and transport protein and has been shown to interact with protein kinase C alpha (PKC alpha), AMPA-type glutamate receptors, and several other membrane receptors via its PDZ domain. The interaction of PICK 1 with PKC alpha is highly dependent on the activation of the kinase. It appears that PICK 1 directs the activated form of PKC alpha to membrane anchored GluR2. Once phosphorylated by PKC alpha, GluR2 is released from the synaptic anchor proteins. Once released, GluR2 is transported from the synaptic membrane in a PICK 1-dependent manner.

Alternate Names

alpha binding protein, dJ1039K5, MGC15204, PICK, PRKCA-binding protein, PRKCABPprotein interacting with PRKCA, Protein interacting with C kinase 1, protein interacting with PRKCA 1, Protein kinase C-alpha-binding protein

Gene Symbol

PICK1

Additional PICK1 Products

Product Documents for PICK1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PICK1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PICK1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PICK1 Antibody - BSA Free and earn rewards!

Have you used PICK1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for PICK1 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Here is a difficult request. We are looking for an antibody with the following specifications: Anti-PICK1 Reactive in mouse without sodium azide, so it can be injected into the mouse without compromising its life With PBS (for example) It does not necessarily have to be guaranteed. Have you got anything like it?

    A: Unfortunately all of our anti-PICK1 mouse-reactive antibodies are supplied in sodium azide. We do have anti human PICK1 without preservatives, but that would not be suitable if you are working with mouse samples. NB100-41403 contains only 0.02% sodium azide which is the lowest percentage. We also offer an Antibody Concentration and Clean Up Antibody Purification Kit which can be used to reduce the concentration of unwanted additives often found in antibody formulations, such as sodium azide, glycine or tris. This kit is offered in two sizes: cat# 861-0005 includes 1 column and cat# 861-0010 includes 3 columns.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...