PIEZO2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58161

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QFQFFQEAVPPNDYYARLFGIKSVIQTDCSSTWKIIVNPDLS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PIEZO2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PIEZO2 Antibody [NBP2-58161]

Immunocytochemistry/ Immunofluorescence: PIEZO2 Antibody [NBP2-58161]

Immunocytochemistry/Immunofluorescence: PIEZO2 Antibody [NBP2-58161] - Staining of human cell line HeLa shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.

Applications for PIEZO2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PIEZO2

Coming from the Greek ''piesi'' and meaning "pressure", PIEZO2 is integral to the membrane and is involved in ion channel activity, cation channel activity and the regulation of membrane potential. Having between 24 and 36 transmembrane domains, PIEZO's are big transmembrane proteins found in a variety of species. More specifically, PIEZO2 is required for rapidly adapting mechanically activated current in somatosensory and DRG neurons.

Long Name

PIEZO2

Alternate Names

C18orf30, C18orf58, DA3, DA5, DAIPT, FAM38B, FAM38B2, family with sequence similarity 38, member A pseud, family with sequence similarity 38, member B2, HsT748, HsT771, MWKS, piezo-type mechanosensitive ion channel component

Gene Symbol

PIEZO2

Additional PIEZO2 Products

Product Documents for PIEZO2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PIEZO2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PIEZO2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PIEZO2 Antibody - BSA Free and earn rewards!

Have you used PIEZO2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for PIEZO2 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: In my project we need Anti Piezo2 and we find it in your catalogs. PIEZO2 Antibody. I want to know the prediction size of your antibody. The size of the protein is more than 200 kd. but in this photo there there are some sharp band are there the actual bands?

    A: The predicted molecular weights for this protein are based on the multiple transcripts associated with this protein. Please see Ensembl for detailed information. Those expected molecular weights are the following: 318.1, 80.8, 73.8, 62.7 kDa. We see this kind of staining across many of our antibodies for PIEZO2. It would appear that the transcript present is dependent on the tissue type. Based on protein arrays, we do believe that this antibody is specific.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...