PIK3C2G Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-25052PEP

Novus Biologicals
Loading...

Key Product Details

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIK3C2G

Source: E.coli

Amino Acid Sequence: PNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGKIPHYESEIDENTFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELSWHQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25052It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-25052PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PIK3C2G

PIK3C2G, also known as Phosphatidylinositol-4-Phosphate 3-Kinase, Catalytic Subunit Type 2 Gamma, is 1,485 amino acids long and approximately 171 kDa. PIK3C2G belongs to the PI 3-Kinase family. Although little is known about the function of PIK3C2G, PI3K family members play a role in the regulation of intracellular trafficking, cell survival and proliferation, and oncogenesis. PIK3C2G research is currently being conducted in relation to several diseases and disorders such as alcoholism, schizophrenia and Kaposi's sarcoma. PIK3C2G has been shown to have interactions with other PI3/PI4-kinase members such as PI4KA, PI4KB, PI4K2A, PI4K2B and PIP5K1B in pathways including the mTOR pathway, TGF-beta Pathway, NF-kappaB Pathway and Phosphatidylinositol signaling system.

Long Name

Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma

Alternate Names

PI3K-C2-gamma

Gene Symbol

PIK3C2G

Additional PIK3C2G Products

Product Documents for PIK3C2G Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PIK3C2G Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for PIK3C2G Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review PIK3C2G Recombinant Protein Antigen and earn rewards!

Have you used PIK3C2G Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...