PLAGL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56498

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PLAGL1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QELMKESLQTGDLLSTFHTISPSFQLKAAALPPFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PLAGL1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PLAGL1 Antibody [NBP2-56498]

Immunocytochemistry/ Immunofluorescence: PLAGL1 Antibody [NBP2-56498]

Immunocytochemistry/Immunofluorescence: PLAGL1 Antibody [NBP2-56498] - Staining of human cell line U-2 OS shows localization to nuclear bodies, the Golgi apparatus & vesicles.
PLAGL1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: PLAGL1 Antibody - BSA Free [NBP2-56498]

Chromatin Immunoprecipitation-exo-Seq: PLAGL1 Antibody - BSA Free [NBP2-56498]

ChIP-Exo-Seq composite graph for Anti-PLAGL1 (NBP2-56498) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for PLAGL1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PLAGL1

PLAGL1 encodes a C2H2 zinc finger protein with transactivation and DNA-binding activity. This gene has been shown to exhibit antiproliferative activities and is a tumor suppressor gene candidate. Many transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

DKFZp781P1017, LOT-1, LOT1ZACLost on transformation 1, MGC126275, MGC126276, PLAG-like 1, pleiomorphic adenoma gene-like 1, pleiomorphic adenoma gene-like protein 1, Pleiomorphic adenoma-like protein 1, Tumor supressor ZAC, ZAC tumor supressor, ZAC1, zinc finger protein PLAGL1

Gene Symbol

PLAGL1

Additional PLAGL1 Products

Product Documents for PLAGL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PLAGL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PLAGL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PLAGL1 Antibody - BSA Free and earn rewards!

Have you used PLAGL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies