PLTP Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10028

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PLTP Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PLTP (NP_001229849.1). Peptide sequence EFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISE

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit PLTP Antibody - BSA Free (NBP3-10028) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for PLTP Antibody - BSA Free

Western Blot: PLTP Antibody [NBP3-10028]

Western Blot: PLTP Antibody [NBP3-10028]

Western Blot: PLTP Antibody [NBP3-10028] - Western blot analysis of PLTP in Human Jurkat Whole Cell lysates. Antibody dilution at 1ug/ml

Applications for PLTP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PLTP

Phospholipid transfer protein (PLTP) plays a central role in regulating plasma HDL levels and distribution of HDL subpopulations. This regulation is evidenced in vivo by markedly reduced plasma HDL levels in PLTP gene knock-out mice. PLTP also facilitates free cholesterol influx into HDL and whereby plays a role in cholesterol metabolism.

Long Name

Phospholipid Transfer Protein

Alternate Names

HDLCQ9, Lipid transfer protein II, phospholipid transfer protein

Gene Symbol

PLTP

Additional PLTP Products

Product Documents for PLTP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PLTP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PLTP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PLTP Antibody - BSA Free and earn rewards!

Have you used PLTP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies