PLVAP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83911

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Biological Validation

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Electron Microscopy

Cited:

Immunohistochemistry-Paraffin, Western Blot, Electron Microscopy

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PLVAP Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRSLDNLGYNLYHPLGSELASIRRACDHMPSLMSSKVEELARSLRADIERVARENSDLQRQKLEAQQGLRASQEAKQKVEKEAQAREAKLQAECSR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit PLVAP Antibody - BSA Free (NBP1-83911) is a polyclonal antibody validated for use in IHC and WB. Anti-PLVAP Antibody: Cited in 6 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for PLVAP Antibody - BSA Free

Western Blot: PLVAP Antibody [NBP1-83911]

Western Blot: PLVAP Antibody [NBP1-83911]

Western Blot: PLVAP Antibody [NBP1-83911] - Cell lysate from Human Retinal Microvascular Endothelial Cells (HRMECs). PLVAP antibody at a dilution of (1:1000) and overnight incubation at 4C. Left = untreated cells and Right = 24hr VEGFA treatment. Green band = PLVAP and Red band = Actin. Ladder is Odyssey 928-40000 molecular weight marker. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: PLVAP Antibody [NBP1-83911]

Immunohistochemistry-Paraffin: PLVAP Antibody [NBP1-83911]

Immunohistochemistry-Paraffin: PLVAP Antibody [NBP1-83911] - Human kidney. Heat mediated antigen retrieval in citrate buffer (pH 6) at 95C for 20 minutes. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: PLVAP Antibody [NBP1-83911]

Immunohistochemistry-Paraffin: PLVAP Antibody [NBP1-83911]

Immunohistochemistry-Paraffin: PLVAP Antibody [NBP1-83911] - Staining of human duodenum shows strong membranous positivity in endothelial cells.
Immunohistochemistry-Paraffin: PLVAP Antibody [NBP1-83911]

Immunohistochemistry-Paraffin: PLVAP Antibody [NBP1-83911]

Immunohistochemistry-Paraffin: PLVAP Antibody [NBP1-83911] - Staining of human fallopian tube shows strong membranous positivity in endothelial cells.
Immunohistochemistry-Paraffin: PLVAP Antibody [NBP1-83911]

Immunohistochemistry-Paraffin: PLVAP Antibody [NBP1-83911]

Immunohistochemistry-Paraffin: PLVAP Antibody [NBP1-83911] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Paraffin: PLVAP Antibody [NBP1-83911]

Immunohistochemistry-Paraffin: PLVAP Antibody [NBP1-83911]

Immunohistochemistry-Paraffin: PLVAP Antibody [NBP1-83911] - Staining of human tonsil shows strong membranous positivity in endothelial cells.

Applications for PLVAP Antibody - BSA Free

Application
Recommended Usage

Electron Microscopy

Reported in scientific literature (PMID:34280928).

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

Validated by verified customer review.
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 3 reviews rated 4.3 using NBP1-83911 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PLVAP

PLVAP (Plasmalemma vesicle associated protein) is a membrane associated protein of caveolae and is found in fenestral and stomatal diaphragms in fenestrated endothelia and transendothelial channels. Normally in skeletal and cardiac muscle, PLVAP expression is limited to small arterioles and venules; however, under conditions of inflammation, it can be induced on previously non expressing vessels in cardiac muscle. In the central nervous system (CNS), the panendothelial cell antigen expression is developmentally regulated. During embryonic development, the antigen is found on brain vasculature up to day 16 of gestation, after which it disappears. The cessation of PLVAP expression in the CNS may be associated with the establishment of the blood brain barrier, which begins on day 16 of gestation. In the adult mouse, inflammation in the CNS can lead to re expression of the panendothelial cell antigen. This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Long Name

Plasmalemma Vesicle Associated Protein

Alternate Names

FELS, gp68, PV-1, PV1

Gene Symbol

PLVAP

Additional PLVAP Products

Product Documents for PLVAP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PLVAP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PLVAP Antibody - BSA Free

Customer Reviews for PLVAP Antibody - BSA Free (3)

4.3 out of 5
3 Customer Ratings
5 Stars
33%
4 Stars
67%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used PLVAP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 3 of 3 reviews Showing All
Filter By:
Clear Filters X
  • PLVAP Antibody
    Name: Wendy Dailey
    Application: In-Cell Western
    Sample Tested: Human retinal endothelial cells and U937
    Species: Human
    Verified Customer | Posted 03/14/2019
    PLVAP antibody, NBP1-83911, [1:140 ] followed by Goat anti-rabbit IRDYE 800 secondary antibody. CellTag 700 used for normalization. Left = untreated cells and right = 24 hour VEGFA treatment.
    PLVAP Antibody - BSA Free NBP1-83911
  • PLVAP Antibody
    Name: Wendy Dailey
    Application: Western Blot
    Sample Tested: Human retinal endothelial cells
    Species: Human
    Verified Customer | Posted 02/26/2019
    Immunoblot with NBP1-83911 (PLVAP antibody) at a dilution of (1:1000) and over night incubation at 4 C. Left = untreated cells and right = 24 hr VEGFA treatment.Green band = PLVAP & Red band = Actin
    Cell lysate from Human Retinal Microvascular Endothelial Cells (HRMECs) was prepared and loaded onto Mini-protean TGX gel followed by western blot with NBP1-83911 (PLVAP antibody) at a dilution of (1:1000) and incubated over night at 4 C. Left = untreated cells and right = 24 hr VEGFA treatment. Green band = PLVAP and Red band = Actin
    PLVAP Antibody - BSA Free NBP1-83911
  • PLVAP Antibody
    Name: Santhosh Sivajothi
    Application: Immunohistochemistry-Paraffin
    Sample Tested: Human kidney
    Species: Human
    Verified Customer | Posted 05/22/2018
    Heat mediated antigen retrieval was performed by heating in citrate buffer (pH6) at 95C for 20 minutes
    PLVAP Antibody - BSA Free NBP1-83911

There are no reviews that match your criteria.

Showing  1 - 3 of 3 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies