PMCA4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59481

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PMCA4 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ATP2B4(ATPase, Ca++ transporting, plasma membrane 4) The peptide sequence was selected from the middle region of ATP2B4. Peptide sequence FAGEKFFDIDSGRKAPLHSPPSQHYTIVFNTFVLMQLFNEINSRKIHGEK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PMCA4 Antibody - BSA Free

Western Blot: PMCA4 Antibody [NBP1-59481]

Western Blot: PMCA4 Antibody [NBP1-59481]

Western Blot: PMCA4 Antibody [NBP1-59481] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for PMCA4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PMCA4

ATP2B4 belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. ATP2B4 is the plasma membrane calcium ATPase isoform 4.The protein encoded by this gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes the plasma membrane calcium ATPase isoform 4. Alternatively spliced transcript variants encoding different isoforms have been identified.

Alternate Names

ATP2B2plasma membrane calcium ATPase, ATPase, Ca++ transporting, plasma membrane 4, DKFZp686G08106, DKFZp686M088, EC 3.6.3, EC 3.6.3.8, Matrix-remodeling-associated protein 1, matrix-remodelling associated 1, MXRA1, Plasma membrane calcium ATPase isoform 4, plasma membrane calcium pump, Plasma membrane calcium pump isoform 4, plasma membrane calcium-transporting ATPase 4, PMCA4b, PMCA4PMCA4x, sarcolemmal calcium pump

Gene Symbol

ATP2B4

UniProt

B1APW5 (Human)

Additional PMCA4 Products

Product Documents for PMCA4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PMCA4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PMCA4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PMCA4 Antibody - BSA Free and earn rewards!

Have you used PMCA4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies