PMS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58368

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ESVLIALENLMTTCYGPLPSTNSYENNKTDVSAADIVLSKTAETDVLFNKVESSGKNYSNVDTSVIPFQNDMHNDESGKNTDDCLNHQISIGDFGYGHCSS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PMS1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PMS1 Antibody [NBP2-58368]

Immunocytochemistry/ Immunofluorescence: PMS1 Antibody [NBP2-58368]

Immunocytochemistry/Immunofluorescence: PMS1 Antibody [NBP2-58368] - Staining of human cell line PC-3 shows localization to nuclear bodies.
PMS1 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: PMS1 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: PMS1 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-PMS1 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for PMS1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PMS1

PMS1 was identified by its homology to a yeast protein involved in DNA mismatch repair. A role for this protein in mismatch repair has not been proven. However, the protein forms heterodimers with MLH1, a DNA mismatch repair protein, and some cases of hereditary nonpolyposis colorectal cancer have been found to have mutations in the gene.

Alternate Names

DKFZp781M0253, FLJ98259, HNPCC3, hPMS1, human homolog of yeast mutL, mismatch repair gene PMSL1, PMS1 postmeiotic segregation increased 1 (S. cerevisiae), PMS1 protein homolog 1, PMSL1DNA mismatch repair protein PMS1, postmeiotic segregation increased (S. cerevisiae) 1, rhabdomyosarcoma antigen MU-RMS-40.10B, rhabdomyosarcoma antigen MU-RMS-40.10E

Gene Symbol

PMS1

Additional PMS1 Products

Product Documents for PMS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PMS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PMS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PMS1 Antibody - BSA Free and earn rewards!

Have you used PMS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...