POT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57891

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all POT1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for POT1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: POT1 Antibody [NBP2-57891]

Immunocytochemistry/ Immunofluorescence: POT1 Antibody [NBP2-57891]

Immunocytochemistry/Immunofluorescence: POT1 Antibody [NBP2-57891] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
POT1 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: POT1 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: POT1 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-POT1 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for POT1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POT1

POT1 (protection of telomeres 1), a telomere regulator, is a single-stranded telomeric DNA-binding protein that controls telomerase-mediated telomere elongation. Telomere maintenance is required for protection against changes in telomere length, which has been implicated in ageing and certain cancers. Specifically, this protein functions as a member of a multi-protein complex that binds to the TTAGGG repeats of telomeres, regulating telomere length and protecting chromosome ends from illegitimate recombination, catastrophic chromosome instability, and abnormal chromosome segregation. Excessive transcriptional expression of POT1 has been associated with stomach cancers.

Long Name

Protection of Telomeres Protein 1

Alternate Names

DKFZp586D211, HPOT1, POT1 protection of telomeres 1 homolog, POT1-like telomere end-binding protein, protection of telomeres 1 homolog (S. pombe), protection of telomeres protein 1

Gene Symbol

POT1

Additional POT1 Products

Product Documents for POT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for POT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for POT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POT1 Antibody - BSA Free and earn rewards!

Have you used POT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies