PP1 Inhibitor-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79889

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The specific Immunogen is proprietary information. Peptide sequence ASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYH. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PP1 Inhibitor-2 Antibody - BSA Free

Western Blot: PP1 Inhibitor-2 Antibody [NBP1-79889]

Western Blot: PP1 Inhibitor-2 Antibody [NBP1-79889]

Western Blot: PP1 Inhibitor-2 Antibody [NBP1-79889] - Titration: 1.0 ug/ml Positive Control: THP-1 Whole Cell.

Applications for PP1 Inhibitor-2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PP1 Inhibitor-2

Two inhibitors of protein phosphatase 1 (PP1) include the phosphatase inhibitor 1 (IPP-1) and phosphatase inhibitor 2 (IPP-2). IPP-2, also known as I-2, interacts with the catalytic subunit of PP1 to form the heterodimer PP1I. The PP1I complex is present in the cytosol of cells in a broad range of vertebrate and invertebrate species. Although the heterodimer itself is inactive, a reversible phosphorylation of IPP-2 at Thr 72 by glycogen-synthase-kinase (GSK3) initiates activation of the heterodimer complex in vitro. Phosphorylation of IPP-2 by casein kinase-II at Ser 86, Ser 120, and Ser 121 enhances the rate of phosphorylation by GSK3 at Thr 72 and effectively activates the heterodimer complex. Besides moderating PP1 activity, IPP-2 may play a role as a chaperone for the correct folding of PP1. The gene for human IPP-2 maps to chromosome 6 in the major histocompatiblity complex region.

Long Name

Protein Phosphatase 1 Inhibitor 2

Alternate Names

IPP2, PP1 Inhibitor2, PPP1R2

Gene Symbol

PPP1R2

Additional PP1 Inhibitor-2 Products

Product Documents for PP1 Inhibitor-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PP1 Inhibitor-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for PP1 Inhibitor-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PP1 Inhibitor-2 Antibody - BSA Free and earn rewards!

Have you used PP1 Inhibitor-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...