Recombinant Human PP2A alpha GST (N-Term) Protein

Novus Biologicals | Catalog # H00005515-P01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE, Surface Plasmon Resonance (SPR)
Loading...

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-309 of Human PPP2CA

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human PP2A alpha GST (N-Term) Protein

SDS-PAGE: Recombinant Human PP2A alpha GST (N-Term) Protein [H00005515-P01]

SDS-PAGE: Recombinant Human PP2A alpha GST (N-Term) Protein [H00005515-P01]

SDS-Page: Recombinant Human PP2A alpha Protein [H00005515-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00005515-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: PP2A

This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit. [provided by RefSeq]

Alternate Names

PP2CA, PPP2CA, RP-C

Gene Symbol

PPP2CA

Additional PP2A Products

Product Documents for Recombinant Human PP2A alpha GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human PP2A alpha GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations for Recombinant Human PP2A alpha GST (N-Term) Protein

Customer Reviews for Recombinant Human PP2A alpha GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human PP2A alpha GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human PP2A alpha GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...

Associated Pathways

TGF-beta Signaling Pathways TGF-beta Signaling Pathway Thumbnail