PPAR alpha/NR1C1 Recombinant Protein Antigen
Novus Biologicals | Catalog # NBP2-57777PEP
Key Product Details
Source
Tag
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: HDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTE
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation, and Storage
NBP2-57777PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: PPAR alpha/NR1C1
Long Name
Alternate Names
Gene Symbol
Additional PPAR alpha/NR1C1 Products
Product Documents for PPAR alpha/NR1C1 Recombinant Protein Antigen
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PPAR alpha/NR1C1 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for PPAR alpha/NR1C1 Recombinant Protein Antigen
There are currently no reviews for this product. Be the first to review PPAR alpha/NR1C1 Recombinant Protein Antigen and earn rewards!
Have you used PPAR alpha/NR1C1 Recombinant Protein Antigen?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
FAQs for PPAR alpha/NR1C1 Recombinant Protein Antigen
-
Q: Please differentiate to me between PPAR and PGC clearly. I am confused with the difference between these two
A:
Thank you very much for contacting Novus Biologicals technical support team and sharing your query on the differences between PGC-1 alpha and PPAR. These are two different proteins encoded by their respective genes and serves different functions. PGC-1 alpha (PGC1A or PPAR gamma coactivator 1-alpha) is a transcriptional co-activator for steroid receptors and nuclear receptors, and it regulates diverse aspects of cellular physiology. It up-regulates the transcriptional activity of PPAR-gamma /thyroid hormone receptor on the uncoupling protein promoter; regulates the key mitochondrial genes involved in adaptive thermogenesis; implicates in the metabolic reprogramming in response to nutrients availability through the coordination of the expression of a wide array of genes involved in the regulation of glucose and fatty acid metabolism. Among our PGC-1 alpha antibodies, NBP1-04676 is our best selling product with nice customer feedback and citations in at least 13 research publications. PPAR (PPAR alpha) on the other hand is a ligand-activated transcription factor which gets activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine, and oleylethanolamide (a naturally occurring lipid that regulates satiety), and acts as a key regulator of lipid metabolism. It also acts as a receptor for peroxisome proliferators such as hypolipidemic drugs and fatty acids. It regulates the peroxisomal beta-oxidation pathway of fatty acids, and also functions as transcription activator for the ACOX1 and P450 genes. We have a variety of PPAR alpha antibodies. I hope you will find this information helpful but please let me know if I can support you with anything else from my end. Thank you very much for choosing Novus Biologicals as your quality reagent supplier and we wish you the best with your research projects.