PPP1R3B Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-82243PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
View all PPP1R3B Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP1R3B.

Source: E. coli

Amino Acid Sequence: DRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82243.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-82243PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PPP1R3B

PPP1R3B, the protein phosphatase-1 (PP1) catalytic subunit (PPP1CA; MIM 176875) is regulated by targeting subunits, such as PP1R3B. PP1R3B suppresses the rate at which PP1 dephosphorylates (i.e., inactivates) glycogen phosphorylase (see PYGL; MIM 232700) and enhances the rate at which it activates glycogen synthase (see GYS2; MIM 138571) (Doherty et al., 1995 [PubMed 7498521]).[supplied by OMIM]

Alternate Names

FLJ14005, FLJ34675, GL, Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL, PPP1R4PP1 subunit R4, protein phosphatase 1 regulatory subunit 3B, Protein phosphatase 1 regulatory subunit 4, Protein phosphatase 1 subunit GL, protein phosphatase 1, regulatory (inhibitor) subunit 3B

Gene Symbol

PPP1R3B

Additional PPP1R3B Products

Product Documents for PPP1R3B Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PPP1R3B Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for PPP1R3B Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review PPP1R3B Recombinant Protein Antigen and earn rewards!

Have you used PPP1R3B Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes