PPP3CC Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-25065PEP

Novus Biologicals
Loading...

Key Product Details

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP3CC

Source: E.coli

Amino Acid Sequence: RAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25065It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-25065PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PPP3CC

Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation and a unique form of calcineurin appears to be associated with the flagellum. The calcineurin holoenzyme is composed of catalytic and regulatory subunits of 60 and 18 kD, respectively. At least 3 genes, calcineurin A-alpha (CALNA1; MIM 114105), calcineurin A-beta (CALNA2; MIM 114106), and calcineurin A-gamma (CALNA3), have been cloned for the catalytic subunit. These genes have been identified in humans, mice, and rats, and are highly conserved between species (90 to 95% amino acid identity).[supplied by OMIM]

Long Name

Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform

Alternate Names

CALNA3, CNA3

Gene Symbol

PPP3CC

Additional PPP3CC Products

Product Documents for PPP3CC Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PPP3CC Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for PPP3CC Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review PPP3CC Recombinant Protein Antigen and earn rewards!

Have you used PPP3CC Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...