PR48 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58174

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to PPP2R3B(protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta) The peptide sequence was selected from the C terminal of PPP2R3B. Peptide sequence ELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQ The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: B.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PR48 Antibody - BSA Free

Western Blot: PR48 Antibody [NBP1-58174]

Western Blot: PR48 Antibody [NBP1-58174]

Western Blot: PR48 Antibody [NBP1-58174] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for PR48 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PR48

Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. PPP2R3B belongs to the B'' family. The B'' family has been further divided into subfamilies. PPP2R3B belongs to the beta subfamily of regulatory subunit B''.Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B'' family. The B'' family has been further divided into subfamilies. The product of this gene belongs to the beta subfamily of regulatory subunit B''. Alternative splicing results in multiple transcript variants encoding different isoforms.

Alternate Names

FLJ60425, NYREN8, NY-REN-8 antigen, PP2A subunit B isoform PR48, PP2A, subunit B, PR48 isoform, PPP2R3L, PPP2R3LY, PR48, protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta, protein phosphatase 2, regulatory subunit B'', beta, Protein phosphatase 2A 48 kDa regulatory subunit, serine/threonine protein phosphatase 2A, 48kDa regulatory subunit B, serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta

Gene Symbol

PPP2R3B

UniProt

Additional PR48 Products

Product Documents for PR48 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PR48 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PR48 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PR48 Antibody - BSA Free and earn rewards!

Have you used PR48 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...