PRL-3/PTP4A3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84229

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PRL-3/PTP4A3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PRL-3/PTP4A3. Peptide sequence: LGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PRL-3/PTP4A3 Antibody - BSA Free

Western Blot: PRL-3/PTP4A3 Antibody [NBP2-84229]

Western Blot: PRL-3/PTP4A3 Antibody [NBP2-84229]

Western Blot: PRL-3/PTP4A3 Antibody [NBP2-84229] - WB Suggested Anti-PTP4A3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 293T cell lysatePTP4A3 is supported by BioGPS gene expression data to be expressed in HEK293T

Applications for PRL-3/PTP4A3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PRL-3/PTP4A3

PRL-3 is encoded by this gene belongs to a small class of prenylated protein tyrosine phosphatases (PTPs). PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. This class of PTPs contain a PTP domain and a characteristic C-terminal prenylation motif. Studies of this class of PTPs in mice demonstrated that they were prenylated proteins in vivo, which suggested their association with cell plasma membrane. Overexpression of this gene in mammalian cells was reported to inhibit angiotensin-II induced cell calcium mobilization and promote cell growth. Two alternatively spliced variants exist.

Long Name

Phosphatase of Regenerating Liver 3

Alternate Names

PRL3, PTP4A3

Gene Symbol

PTP4A3

Additional PRL-3/PTP4A3 Products

Product Documents for PRL-3/PTP4A3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PRL-3/PTP4A3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Phosphatases and Regulators

Customer Reviews for PRL-3/PTP4A3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PRL-3/PTP4A3 Antibody - BSA Free and earn rewards!

Have you used PRL-3/PTP4A3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies