Prohibitin 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98312

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen for this antibody is prohibitin 2 - middle region. Peptide sequence REYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Prohibitin 2 Antibody - BSA Free

Western Blot: Prohibitin 2 Antibody [NBP1-98312]

Western Blot: Prohibitin 2 Antibody [NBP1-98312]

Western Blot: Prohibitin 2 Antibody [NBP1-98312] - WB Suggested Anti-Phb2 Antibody. Positive Control: Lane 1: 80ug mouse brain extractLane 2: 80ug rat brain extract. Primary Antibody Dilution : 1:500. Secondary Antibody : IRDye 800 CW goat anti-rabbit from Li-COR Bioscience.
Western Blot: Prohibitin 2 Antibody [NBP1-98312]

Western Blot: Prohibitin 2 Antibody [NBP1-98312]

Western Blot: Prohibitin 2 Antibody [NBP1-98312] - Mouse Heart Lysate 1.0ug/ml, Gel Concentration: 12%
Immunoprecipitation: Prohibitin 2 Antibody [NBP1-98312]

Immunoprecipitation: Prohibitin 2 Antibody [NBP1-98312]

Immunoprecipitation: Prohibitin 2 Antibody [NBP1-98312] - NT2 CELL/BRAIN TISSUE

Applications for Prohibitin 2 Antibody - BSA Free

Application
Recommended Usage

Immunoprecipitation

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Prohibitin 2

REA, or repressor of estrogen receptor activity, (also known as BAP37, or B-cell receptor-associated protein) is a 37 kD erythrocyte band 7 integral membrane protein that contains an SPFH domain. It is located in the inner mitochondrial membrane that selectively potentiates the inhibitory effectiveness of antiestrogen-occupied ER. REA plays a possible role in cell aging and acts as a mitochondrial protein chaperone. This protein has been shown to interact with the estrogen receptor, prohibitin, and IgM.

Alternate Names

BAP, Bap37, BCAP37, D-Prohibitin, p22, PHB2, PNAS-141, REA

Gene Symbol

PHB2

Additional Prohibitin 2 Products

Product Documents for Prohibitin 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Prohibitin 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Prohibitin 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Prohibitin 2 Antibody - BSA Free and earn rewards!

Have you used Prohibitin 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies