Prostate and testis expressed protein 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-05564

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Prostate and testis expressed protein 3 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human Prostate and testis expressed protein 3 (NP_001123355.3). MNKHFLFLFLLYCLIVAVTSLQCITCHLRTRTDRCRRGFGVCTAQKGEACMLLRIYQRNTLQISYMVCQKFCRDMTFDLRNRTYVHTCCNYNYCNFKL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Prostate and testis expressed protein 3 Antibody - BSA Free

Western Blot: Prostate and testis expressed protein 3 AntibodyBSA Free [NBP3-05564]

Western Blot: Prostate and testis expressed protein 3 AntibodyBSA Free [NBP3-05564]

Western Blot: Prostate and testis expressed protein 3 Antibody [NBP3-05564] - Western blot analysis of extracts of HeLa cells, using Prostate and testis expressed protein 3 antibody (NBP3-05564). Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.

Applications for Prostate and testis expressed protein 3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Prostate and testis expressed protein 3

Alternate Names

acrosomal vesicle protein HEL-127, HEL-127, PATE-DJ, PATE-like protein DJ, secreted TFP/Ly-6/uPAR protein PATE-DJ

Additional Prostate and testis expressed protein 3 Products

Product Documents for Prostate and testis expressed protein 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Prostate and testis expressed protein 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Prostate and testis expressed protein 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Prostate and testis expressed protein 3 Antibody - BSA Free and earn rewards!

Have you used Prostate and testis expressed protein 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies