Recombinant S. aureus Protein A Protein
Novus Biologicals | Catalog # NBP3-07005
![SDS-PAGE: Recombinant S. aureus Protein A Protein [NBP3-07005]](https://resources.rndsystems.com/images/products/Recombinant-S.-aureus-Protein-A-Protein-SDS-Page-NBP3-07005-img0001.jpg "SDS-PAGE: Recombinant S. aureus Protein A Protein [NBP3-07005]")
Product Specifications
Description
Source: E.coli
Amino Acid Sequence: MAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDNKKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPET
Purity
Endotoxin Level
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Protein / Peptide Type
Scientific Data Images for Recombinant S. aureus Protein A Protein
SDS-PAGE: Recombinant S. aureus Protein A Protein [NBP3-07005]
SDS-Page: Recombinant S. aureus Protein A Protein [NBP3-07005] - Protein A, 48.1 kDa (434aa), confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE.Formulation, Preparation, and Storage
NBP3-07005
| Formulation | 20 mM Tris-HCl buffer (pH 8.0), 10% glycerol |
| Preservative | No Preservative |
| Concentration | 1 mg/ml |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Background: Protein A
Alternate Names
Gene Symbol
Additional Protein A Products
Product Documents for Recombinant S. aureus Protein A Protein
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Recombinant S. aureus Protein A Protein
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Customer Reviews for Recombinant S. aureus Protein A Protein
There are currently no reviews for this product. Be the first to review Recombinant S. aureus Protein A Protein and earn rewards!
Have you used Recombinant S. aureus Protein A Protein?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
FAQs for Recombinant S. aureus Protein A Protein
-
Q: During my master thesis, I am working on a large scale ribosome affinity purification in Trypanosoma brucei. Unfortunately, we have some problems with the present antibody (IgG against protein A, extracted from chicken). Therefore, we are searching a better and more efficient alternative. Ideally it is extracted from guinea pig, rat, mouse or rabbit. Searching suitable antibodies, I found you have some in your range of products. Since we need to work large scale and will need a bigger amount of antibodies the next months, we would like to get the possibility to test the new antibodies first. Therefore I would like to ask for an aliquot for testing. You would really help me finding an good alternative!
A:
We unfortunately cannot offer testing samples of our antibodies. I am sorry for any inconvenience. We do have two antibodies to Protein A that meet your host requirements. We fully guarantee our antibodies for all listed species and applications. For any applications and/or species not listed, we offer our Innovators Reward Program. In exchange for a review of your experiment using our product in an untested application or species, we will issue you a credit for the purchase price of the antibody.