ProTx II

Catalog # Availability Size / Price Qty
4023/100U
Voltage-gated Sodium Channel Blockers Peptide
1 Image
Description: Selective NaV1.7 channel blocker
Product Details
Citations (2)
Reviews

Biological Activity

Selective NaV1.7 channel blocker. Shifts activation gating positively and decreases current magnitude. Displays 100-fold selectivity over other sodium channel subtypes.

Technical Data

M.Wt:
3826.59
Formula:
C168H250N46O41S8
Sequence:
YCQKWMWTCDSERKCCEGMVCRLWCKKKLW

(Modifications: Disulfide bridge: 2-16, 9-21, 15-25)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
484598-36-9

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

or select another batch:
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Citations for ProTx II

The citations listed below are publications that use Tocris products. Selected citations for ProTx II include:

2 Citations: Showing 1 - 2

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for ProTx II

There are currently no reviews for this product. Be the first to review ProTx II and earn rewards!

Have you used ProTx II?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.