hh ProTx II (CAS 484598-36-9): R&D Systems
Catalog Number: 4023
Biological Activity
Selective NaV1.7 channel blocker. Shifts activation gating positively and decreases current magnitude. Displays 100-fold selectivity over other sodium channel subtypes.
Technical Data
  • M.Wt:
    3826.59
  • Formula:
    C168H250N46O41S8
  • Sequence:
    YCQKWMWTCDSERKCCEGMVCRLWCKKKLW

    (Modifications: Disulfide bridge: 2-16, 9-21, 15-25)

  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Store at -20°C
  • CAS No:
    484598-36-9
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Molecular interactions of the gating modifier toxin ProTx-II with NaV 1.5: implied existence of a novel toxin binding site coupled to activation.
    Smith et al.
    J.Biol.Chem., 2007;282:12687
  2. Evidence for multiple effects of ProTxII on activation gating in NaV 1.5.
    Edgerton et al.
    Toxicon., 2008;52:489
  3. ProTx-II, a selective inhibitor of NaV 1.7 sodium channels, blocks action potential propagation in nociceptors.
    Schmalhofer et al.
    Mol.Pharmacol., 2008;74:1476

Have you used ProTx II?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information