PRY Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09513

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PRY Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PRY (NP_004667). Peptide sequence RGLEARRKKDLKDSFLWRYGKVGCISLPLREMTAWINPPQISEIFQGYHQ

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PRY Antibody - BSA Free

Western Blot: PRY Antibody [NBP3-09513]

Western Blot: PRY Antibody [NBP3-09513]

Western Blot: PRY Antibody [NBP3-09513] - Western blot analysis of PRY in A549 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for PRY Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PRY

The PRY gene is located in the nonrecombining portion of the Y chromosome, and expressed specifically in testis. It encodes a protein which has a low degree of similarity to protein tyrosine phosphatase, non-receptor type 13. Two nearly identical copies of t

Alternate Names

PRY1testis-specific PTP-BL-related protein on Y, PTPN13-like protein, Y-linked, PTPN13-like, Y-linked, PTPN13LYPTPN13LY2, Testis-specific PTP-BL-related Y protein

Gene Symbol

PRY

Additional PRY Products

Product Documents for PRY Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PRY Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PRY Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PRY Antibody - BSA Free and earn rewards!

Have you used PRY Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies