Catalog Number: 5042
Alternate Names: PcTx1
Biological Activity
Potent and selective acid-sensing ion channel 1a (ASIC1a) blocker (IC50 = 0.9 nM). Displays no effect at ASIC1b, ASIC2a, ASIC3, heteromeric ASIC channels, ENaC and KV2.1/2.2/4.2/4.3 channels expressed in oocytes, at concentrations up to 100 nM. Displays potent analgesic properties against thermal, mechanical, chemical, inflammatory and neuropathic pain in rodents.
Technical Data
  • M.Wt:
    4689.41
  • Formula:
    C200H312N62O57S6
  • Sequence:
    EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT

    (Modifications: Disulfide bridge: 3-18, 10-23, 17-33)

  • Solubility:
    Soluble to 2 mg/ml in water
  • Storage:
    Store at -20°C
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. The receptor site of the spider toxin PcTx1 on the proton-gated cation channel ASIC1a.
    Salinas et al.
    J.Physiol., 2006;570:339
  2. A tarantula peptide against pain via ASIC1a channels and opioid mechanisms.
    Mazzuca et al.
    Nat.Neurosci., 2007;10:943
  3. Isolation of a tarantula toxin specific for a class of proton-gated Na+ channels.
    Escoubas et al.
    J.Biol.Chem., 2000;275:25116
  4. Recombinant production and solution structure of PcTx1, the specific peptide inhibitor of ASIC1a proton-gated cation channels.
    Escoubas et al.
    Protein Sci., 2003;12:1332

Have you used Psalmotoxin 1?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information