PSGR Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86757

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PSGR Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PSGR. Peptide sequence: VRVVMGDIYLLLPPVINPIIYGAKTKQIRTRVLAMFKISCDKDLQAVGGK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit PSGR Antibody - BSA Free (NBP2-86757) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for PSGR Antibody - BSA Free

Western Blot: PSGR Antibody [NBP2-86757]

Western Blot: PSGR Antibody [NBP2-86757]

Western Blot: PSGR Antibody [NBP2-86757] - WB Suggested Anti-OR51E2 Antibody. Titration: 1.0 ug/ml. Positive Control: HepG2 Whole Cell

Applications for PSGR Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSGR

Prostate-specific G protein-coupled receptor possesses homology to the Olfactory Receptor family. It is expressed specifically in normal prostate, and its expression is upregulated in prostate carcinoma. Prostate-specific G protein-coupled receptor has been shown to be expressed primarily in normal prostate and to be overexpressed in prostate carcinoma. In humans, it has also been shown to be expressed in the olfactory epithelium and, to a lesser extent, in the medulla of the brain. ESTs have been isolated from prostate libraries.

Long Name

Prostate-Specific G-Protein Coupled Receptor

Alternate Names

HPRAJ, Olfactory Receptor OR11-16, OR51E2, OR51E3P, OR52A2

Gene Symbol

OR51E2

Additional PSGR Products

Product Documents for PSGR Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PSGR Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PSGR Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PSGR Antibody - BSA Free and earn rewards!

Have you used PSGR Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies