PTBP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57401

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PTBP2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PTBP2 (polypyrimidine tract binding protein 2) The peptide sequence was selected from the N terminal of PTBP2 (BAB71743). Peptide sequence MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PTBP2 Antibody - BSA Free

Western Blot: PTBP2 Antibody [NBP1-57401]

Western Blot: PTBP2 Antibody [NBP1-57401]

Western Blot: PTBP2 Antibody [NBP1-57401] - HepG2 cell lysate, concentration 1.25ug/ml.

Applications for PTBP2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PTBP2

PTBP2 binds to the intronic cluster of RNA regulatory elements, downstream control sequence (DCS). It is implicated in controlling the assembly of other splicing-regulatory proteins. This protein is very similar to the polypyrimidine tract binding protein but it is expressed primarily in the brain.

Alternate Names

brPTB, FLJ34897, neural polypyrimidine tract binding protein, Neural polypyrimidine tract-binding protein, Neurally-enriched homolog of PTB, nPTB, nPTB6, nPTB7, nPTB8, polypyrimidine tract binding protein 2, polypyrimidine tract-binding protein 2, PTB-like protein, PTBPTBLPnPTB5, splicing regulator

Entrez Gene IDs

58155 (Human)

Gene Symbol

PTBP2

UniProt

Q9UKA9-5 (Human)

Additional PTBP2 Products

Product Documents for PTBP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PTBP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PTBP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PTBP2 Antibody - BSA Free and earn rewards!

Have you used PTBP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies