RAB15 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88108

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RAB15 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAB15. Peptide sequence: QTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEVGDATSLPGCGE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RAB15 Antibody - BSA Free

Western Blot: RAB15 Antibody [NBP2-88108]

Western Blot: RAB15 Antibody [NBP2-88108]

Western Blot: RAB15 Antibody [NBP2-88108] - WB Suggested Anti-RAB15 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Human Placenta

Applications for RAB15 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAB15

RAB15, also known as Ras-related protein Rab-15, is a 24 kDa 212 amino acid protein with a shorter, 24 kDa 208 isoform. The gene functions as a regulator of synaptic vesicle membrane flow and may act in unity with RAB3A. Current research is being conducted on RAB15 in relation to differentiating neuroblastoma, pulmonary disease and neuroblastoma. RAB15 is linked to the exocytosis, secretion, endocytosis, cell differentiation, angiogenesis and localization pathways where it interacts with RABIF, RPH3A, ATG5, CLN3 and GABARAPL1.

Alternate Names

RAB15, member RAS oncogene family, RAB15, member RAS onocogene family, ras-related protein Rab-15

Gene Symbol

RAB15

Additional RAB15 Products

Product Documents for RAB15 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAB15 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAB15 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAB15 Antibody - BSA Free and earn rewards!

Have you used RAB15 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies