Recombinant Human Rab20 GST (N-Term) Protein

Novus Biologicals | Catalog # H00055647-P01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray
Loading...

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-234 of Human RAB20

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYCRGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

52.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Rab20 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00055647-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Rab20

RAB20, also known as Ras-related protein Rab-20, is a 234 amino acid protein that is 26 kDa, belongs to the small GTPase superfamily, expressed in 15 of 18 exocrine pancreatic adenocarcinomas, plays a role in apical endocytosis/recycling, maturation and acidification of phagosomes that engulf pathogens such as S.aureus and M.tuberculosis, and in the fusion of phagosomes with lysosomes. This protein is currently being studied for its involvement in hemophagocytic lymphohistiocytosis, pancreatic carcinoma, pancreatitis, adenocarcinoma, and carcinoma. RAB20 protein has interactions with SMURF1, SMAD4 and TGFBR1 in Epithelial Tight Junctions pathway.

Alternate Names

FLJ20429, RAB20, member RAS oncogene family, ras-related protein Rab-20

Gene Symbol

RAB20

Additional Rab20 Products

Product Documents for Recombinant Human Rab20 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human Rab20 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human Rab20 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human Rab20 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human Rab20 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...