Rab25 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10035

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Rab25 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human Rab25 (NP_065120.2). Peptide sequence NVELAFETVLKEIFAKVSKQRQNSIRTNAITLGSAQAGQEPGPGEKRACC

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Rab25 Antibody - BSA Free

Western Blot: Rab25 Antibody [NBP3-10035]

Western Blot: Rab25 Antibody [NBP3-10035]

Western Blot: Rab25 Antibody [NBP3-10035] - Western blot analysis of Rab25 in Human Jurkat Whole Cell lysates. Antibody dilution at 1ug/ml

Applications for Rab25 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Rab25

Members of the Ras-related superfamily of GTP binding proteins, which includes Ras, Rho, Rab and ARF subfamilies, exhibit 30-50% similarity with Ras p21. Rab proteins play an important role for either in endocytosis or in biosynthetic protein transport. The possibility that Rab proteins might also direct the exocytosis from secretory vesicles to the plasma membrane is supported by the observation that in yeast, the SEC4 protein, which is 40% similar to Rab proteins, is associated with secretory vesicles. Rab proteins located on the cytoplasmic face of organelles and vesicles, rab proteins are involved in intracellular membrane fusion reactions. Rab25 was cloned from a gastric parietal cell cDNA library and is expressed in epithelial tissues such as the gastrointestinal mucosae, kidney, and lung, which encoded a protein of 28 kDa

Long Name

RAs Genes from Brain Protein 25

Alternate Names

CATX8, RAB11C

Gene Symbol

RAB25

Additional Rab25 Products

Product Documents for Rab25 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Rab25 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Autophagy
Cancer Biomarkers

Customer Reviews for Rab25 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Rab25 Antibody - BSA Free and earn rewards!

Have you used Rab25 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies