RACK1/GNB2L1 Antibody (7B6J4)

Novus Biologicals | Catalog # NBP3-16277

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7B6J4 expressed in HEK293
View all RACK1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 220-310 of human RACK1/GNB2L1 (P63244). DLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVW

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit RACK1/GNB2L1 Antibody (7B6J4) (NBP3-16277) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for RACK1/GNB2L1 Antibody (7B6J4)

Western Blot: RACK1/GNB2L1 Antibody (7B6J4) [NBP3-16277]

Western Blot: RACK1/GNB2L1 Antibody (7B6J4) [NBP3-16277]

Western Blot: RACK1/GNB2L1 Antibody (7B6J4) [NBP3-16277] - Western blot analysis of extracts of various cell lines, using RACK1/GNB2L1 Rabbit mAb (NBP3-16277) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: RACK1/GNB2L1 Antibody (7B6J4) [NBP3-16277]

Western Blot: RACK1/GNB2L1 Antibody (7B6J4) [NBP3-16277]

Western Blot: RACK1/GNB2L1 Antibody (7B6J4) [NBP3-16277] - Western blot analysis of extracts of various cell lines, using RACK1/GNB2L1 Rabbit mAb (NBP3-16277) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Applications for RACK1/GNB2L1 Antibody (7B6J4)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RACK1

RACK1 (receptor for activated C kinase 1) was identified through its binding to various PKC isoforms. Its main function is to recruit PKC and various other proteins to specific location to form multiprotein complexes, mediating various signal pathways.

Long Name

Receptor for Activated Protein Kinase C 1

Alternate Names

GNB2L1

Gene Symbol

RACK1

Additional RACK1 Products

Product Documents for RACK1/GNB2L1 Antibody (7B6J4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RACK1/GNB2L1 Antibody (7B6J4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RACK1/GNB2L1 Antibody (7B6J4)

There are currently no reviews for this product. Be the first to review RACK1/GNB2L1 Antibody (7B6J4) and earn rewards!

Have you used RACK1/GNB2L1 Antibody (7B6J4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies