RASGRF1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-85603
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RASGRF1. Peptide sequence: PMSEKGKITRGRLGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNG The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for RASGRF1 Antibody - BSA Free
Western Blot: RASGRF1 Antibody [NBP2-85603]
Western Blot: RASGRF1 Antibody [NBP2-85603] - Host: Rabbit. Target Name: RASGRF1. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/mlWestern Blot: RASGRF1 Antibody [NBP2-85603]
Western Blot: RASGRF1 Antibody [NBP2-85603] - WB Suggested Anti-RASGRF1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human brainWestern Blot: RASGRF1 Antibody [NBP2-85603]
Western Blot: RASGRF1 Antibody [NBP2-85603] - Host: Rabbit. Target Name: RASGRF1. Sample Type: Human Fetal Muscle. Antibody Dilution: 1.0ug/mlApplications for RASGRF1 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: RASGRF1
Alternate Names
CDC25guanine nucleotide exchange factor, CDC25L, GNRPguanine nucleotide-releasing factor 1, GRF1, GRF55, guanine nucleotide-releasing factor, 55 kD, Guanine nucleotide-releasing protein, H-GRF55, PP13187, Ras protein-specific guanine nucleotide-releasing factor 1, Ras-GRF1, ras-specific guanine nucleotide-releasing factor 1, Ras-specific guanine nucleotide-releasing factor, CDC25 homolog, Ras-specific nucleotide exchange factor CDC25
Gene Symbol
RASGRF1
Additional RASGRF1 Products
Product Documents for RASGRF1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RASGRF1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for RASGRF1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review RASGRF1 Antibody - BSA Free and earn rewards!
Have you used RASGRF1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...