RASSF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69094

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RASSF1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RASSF1 (Ras association (RalGDS/AF-6) domain family member 1) The peptide sequence was selected form the C terminal of RASSF1. Peptide sequence LAGPSDKALSFVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQIL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RASSF1 Antibody - BSA Free

Western Blot: RASSF1 Antibody [NBP1-69094]

Western Blot: RASSF1 Antibody [NBP1-69094]

Western Blot: RASSF1 Antibody [NBP1-69094] - Human Fetal Lung Cell Lysate, concentration 1 ug/ml.

Applications for RASSF1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RASSF1

This gene encodes a protein similar to the RAS effector proteins. Loss or altered expression of this gene has been associated with the pathogenesis of a variety of cancers, which suggests the tumor suppressor function of this gene. The inactivation of this gene was found to be correlated with the hypermethylation of its CpG-island promoter region. The encoded protein was found to interact with DNA repair protein XPA. The protein was also shown to inhibit the accumulation of cyclin D1, and thus induce cell cycle arrest. Seven alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

Alternate Names

123F2, NORE2A, pancreas-specific ras association domain family 1 protein, Ras association (RalGDS/AF-6) domain family member 1, ras association domain-containing protein 1, RASSF1A, RDA32cardiac-specific ras association domain family 1 protein, REH3P21, tumor suppressor protein RDA32, WUGSC:H_LUCA12.5

Gene Symbol

RASSF1

OMIM

NP_733831 (Human)

Additional RASSF1 Products

Product Documents for RASSF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RASSF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RASSF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RASSF1 Antibody - BSA Free and earn rewards!

Have you used RASSF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies