RBCK1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88131

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RBCK1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human RBCK1. Peptide sequence: LQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RBCK1 Antibody - BSA Free

Western Blot: RBCK1 Antibody [NBP2-88131]

Western Blot: RBCK1 Antibody [NBP2-88131]

Western Blot: RBCK1 Antibody [NBP2-88131] - Host: Rabbit. Target Name: HOIL1. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for RBCK1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RBCK1

RBCK1 is encoded by this gene is similar to mouse UIP28/UbcM4 interacting protein. Alternative splicing has been observed at this locus, resulting in distinct isoforms. [provided by RefSeq]

Alternate Names

C20orf18, EC 6.3.2.-, HBV associated factor 4, HBV-associated factor 4, Heme-oxidized IRP2 ubiquitin ligase 1, Hepatitis B virus X-associated protein 4, HOIL-1, RanBP-type and C3HC4-type zinc finger containing 1, ranBP-type and C3HC4-type zinc finger-containing protein 1, RBCC protein interacting with PKC1, RBCK2, RNF54RING finger protein 54, UBCE7IP3HOIL1, ubiquitin conjugating enzyme 7 interacting protein 3, Ubiquitin-conjugating enzyme 7-interacting protein 3, XAP3, XAP4chromosome 20 open reading frame 18, ZRANB4

Gene Symbol

RBCK1

Additional RBCK1 Products

Product Documents for RBCK1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RBCK1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RBCK1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RBCK1 Antibody - BSA Free and earn rewards!

Have you used RBCK1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies