RELM beta Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-13218PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Applications

Antibody Competition
View all RELM beta Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RETNLB.

Source: E. coli

Amino Acid Sequence: LDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13218.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-13218PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: RELM beta

RELM beta is a family of resistin-like molecules (RELMs) has been identified in rodents and humans. Resistin is a hormone produced by fat cells. RELMalpha is a secreted protein that has a restricted tissue distribution with highest levels in adipose tissue. Another family member, RELMbeta, is a secreted protein expressed only in the gastrointestinal tract, particularly the colon, in both mouse and human. RELMbeta gene expression is highest in proliferative epithelial cells and is markedly increased in tumors, suggesting a role in intestinal proliferation. Resistin and the RELMs share a cysteine composition and other signature features. Thus, the RELMs together with resistin comprise a class of tissue-specific signaling molecules. mRELM-alpha should migrate as a monomer under complete reducing conditions. However, it migrates as dimers, trimers, and even higher order multimers under non-reducing conditions.

Long Name

Resistin-like Molecule beta

Alternate Names

C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich proteinprecursor 2, CCRG, Colon and small intestine-specific cysteine-rich protein, Colon carcinoma-related gene protein, cysteine-rich secreted A12-alpha-like protein 1, Cysteine-rich secreted protein A12-alpha-like 1, Cysteine-rich secreted protein FIZZ2, FIZZ1, FIZZ2RELM-beta, found in inflammatory zone 1, HXCP2XCP2, RELMb, RELMbeta, resistin like beta, resistin-like beta, RETNL2

Gene Symbol

RETNLB

Additional RELM beta Products

Product Documents for RELM beta Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RELM beta Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Obesity

Customer Reviews for RELM beta Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review RELM beta Recombinant Protein Antigen and earn rewards!

Have you used RELM beta Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes