RFC5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38501

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 181-340 of human RFC5 (NP_031396.1).

Sequence:
LMVPRLEHVVEEEKVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RFC5 Antibody - BSA Free

RFC5 Antibody

Western Blot: RFC5 Antibody [NBP3-38501] -

Western Blot: RFC5 Antibody [NBP3-38501] - Western blot analysis of various lysates using RFC5 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for RFC5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RFC5

The Replication factor C (RFC) heteropentamer includes RFC1, RFC2, RFC3, RFC4, and RFC5. The RFC heteropentamer is part of the multiprotein DNA replicase that functions to replicate DNA prior to cell division and repair DNA damage. RFC is the clamp loader ATPase associated with the DNA replicase. As the clamp loader, RFC uses ATP to recruit, open, and close the PCNA ring to link it to DNA for replication and repair. RFC5 is the 36kDa subunit of RFC that forms a core complex with RFC2 and RFC4 and can interact with the C-terminal region of PCNA. RFC5 is also known as replication factor C 36 kDa subunit RF-C 36 kDa subunit, RFC36, Activator 1 36 kDa subunit, A1 36 kDa subunit, and MGC1155.

Alternate Names

Activator 1 36 kDa subunit, Activator 1 subunit 5,36.5 kD subunit, MGC1155, replication factor C (activator 1) 5, 36.5kDa, RF-C 36 kDa subunit, RFC36replication factor C (activator 1) 5 (36.5kD)

Gene Symbol

RFC5

Additional RFC5 Products

Product Documents for RFC5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RFC5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RFC5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RFC5 Antibody - BSA Free and earn rewards!

Have you used RFC5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...