RGM-C/Hemojuvelin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79531

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RGM-C/Hemojuvelin Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human HFE2. Peptide sequence SSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RGM-C/Hemojuvelin Antibody - BSA Free

Western Blot: RGM-C/Hemojuvelin Antibody [NBP1-79531]

Western Blot: RGM-C/Hemojuvelin Antibody [NBP1-79531]

Western Blot: RGM-C/Hemojuvelin Antibody [NBP1-79531] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.

Applications for RGM-C/Hemojuvelin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RGM-C/Hemojuvelin

The product of this gene is involved in iron metabolism. It may be a component of the signaling pathway which activates hepcidin or it may act as a modulator of hepcidin expression. It could also represent the cellular receptor for hepcidin. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Defects in this gene are the cause of hemochromatosis type 2A, also called juvenile hemochromatosis (JH). JH is an early-onset autosomal recessive disorder due to severe iron overload resulting in hypogonadotrophic hypogonadism, hepatic fibrosis or cirrhosis and cardiomyopathy, occurring typically before age of 30. [provided by RefSeq]

Long Name

Repulsive Guidance Molecule C

Alternate Names

DL-M, Hemojuvelin, HFE2, HJV, JH, RGMC

Gene Symbol

HJV

UniProt

NP_973733 (Human)

Additional RGM-C/Hemojuvelin Products

Product Documents for RGM-C/Hemojuvelin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RGM-C/Hemojuvelin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

BMP Family

Customer Reviews for RGM-C/Hemojuvelin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RGM-C/Hemojuvelin Antibody - BSA Free and earn rewards!

Have you used RGM-C/Hemojuvelin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies