RIOK2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35219

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RIOK2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 253-552 of human RIOK2 (NP_060813.2).

Sequence:
TSHPNAEWYFDRDVKCIKDFFMKRFSYESELFPTFKDIRREDTLDVEVSASGYTKEMQADDELLHPLGPDDKNIETKEGSEFSFSDGEVAEKAEVYGSENESERNCLEESEGCYCRSSGDPEQIKEDSLSEESADARSFEMTEFNQALEEIKGQVVENNSVTEFSEEKNRTENYNRQDGQRVQGGVPAGSDEYEDECPHLIALSSLNREFRPFRDEENVGAMNQYRTRTLSITSSGSAVSCSTIPPELVKQKVKRQLTKQQKSAVRRRLQKGEANIFTKQRRENMQNIKSSLEAASFWGE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RIOK2 Antibody - BSA Free

RIOK2 Antibody

Western Blot: RIOK2 Antibody [NBP3-35219] -

Western Blot: RIOK2 Antibody [NBP3-35219] - Western blot analysis of various lysates using RIOK2 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for RIOK2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RIOK2

RIO kinase 2 (RIOK2) is a member of the RIO family of atypical serine protein kinases first characterized in yeast. There are three RIO kinase subfamilies: RIO1, RIO2, and RIO3. RIOK1 and RIOK2 proteins are present in organisms from Archaea to humans. Studies of RIO kinases in yeast indicate that they play a role in ribosome biogenesis. Human RIOK2 has been shown to be a part of a late 40S pre-ribosomal particle and have influence on 40S maturation.

Long Name

Serine/threonine-protein kinase RIO2

Alternate Names

RIO kinase 2, RIO2

Gene Symbol

RIOK2

Additional RIOK2 Products

Product Documents for RIOK2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RIOK2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RIOK2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RIOK2 Antibody - BSA Free and earn rewards!

Have you used RIOK2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies