RNF20 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52985

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RNF20 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RNF20(ring finger protein 20) The peptide sequence was selected from the N terminal of RNF20. Peptide sequence LKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RNF20 Antibody - BSA Free

Western Blot: RNF20 Antibody [NBP1-52985]

Western Blot: RNF20 Antibody [NBP1-52985]

Western Blot: RNF20 Antibody [NBP1-52985] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for RNF20 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RNF20

RNF20 shares similarity with BRE1 of S. cerevisiae. Yeast BRE1 is an ubiquitin ligase required for the ubiquitination of histone H2B and the methylation of histone H3. The protein encoded by this gene shares similarity with BRE1 of S. cerevisiae. Yeast BRE1 is a ubiquitin ligase required for the ubiquitination of histone H2B and the methylation of histone H3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

BRE1, BRE1 E3 ubiquitin ligase homolog, BRE1-A, BRE1AMGC129667, E3 ubiquitin-protein ligase BRE1A, EC 6.3.2, EC 6.3.2.-, FLJ11189, FLJ20382, hBRE1MGC129668, homolog of S. cerevisiae BRE1, KAIA2779, ring finger protein 20KIAA2779

Gene Symbol

RNF20

UniProt

Q5VTR2 (Human)

Additional RNF20 Products

Product Documents for RNF20 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RNF20 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RNF20 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RNF20 Antibody - BSA Free and earn rewards!

Have you used RNF20 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies