ROBO2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-81399
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Rat, Monkey
Cited:
Human, Mouse, Rat, Primate - Macaca mulatta (Rhesus Macaque)
Applications
Validated:
Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Cited:
Knockout Validated, Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant ROBO2 Protein corresponding to amino acids: PVNNSNSGPNEIGNFGRGDVLPPVPGQGDKTATMLSDGAIYSSIDFTTKTSYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSIQQKTDLMGFGYSLPDQNKGNNGGKGGKKKKNKNSSKPQKNNGSTWA
Reactivity Notes
Mouse, rat and monkey reported in scientific literature (PMID: 32220420).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Knockout (KO) Validated Rabbit ROBO2 Antibody - BSA Free (NBP1-81399) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-ROBO2 Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for ROBO2 Antibody - BSA Free
Immunohistochemistry: ROBO2 Antibody [NBP1-81399]
ROBO2-Antibody-Immunohistochemistry-NBP1-81399-img0017.jpgImmunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399]
Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human cerebral cortex shows moderate positivity in neuronal processes in neuropil.Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399]
Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human kidney shows negative to very weak cytoplasmic positivity in cells in tubules.Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399]
Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399]
Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399]
Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of mouse embryo E14 shows strong positivity in developing olfactory bulb and olfactory nerve.Immunohistochemistry: ROBO2 Antibody [NBP1-81399] -
Immunohistochemistry: ROBO2 Antibody [NBP1-81399] - Lateral positioning of ROBO1-expressing longitudinal axons in Nova1/2 dKO embryos.(A) Anti-ROBO1 staining of transverse sections of E12.5 lumbar spinal cords. The antibodies do not distinguish between isoforms. ROBO1 was expressed at a low level on precrossing axons & was highly upregulated on postcrossing axons in both WT & Nova1/2 dKO embryos. ROBO1-expressing axons displayed the same lateral positioning defect as anti-L1 labeled axons (compare with Figure 4B). Reducing Robo1(e6b+) partially rescued the lateral positioning defect in Nova1/2 dKO embryos, while reducing Robo2(e6b+) alone did not rescue. Reducing Robo1/2(e6b+) together further rescued the defect. Arrows indicate the lateral funiculus (LF) & ventral funiculus (VF). Scale bar, 50 μm. (B) Quantification of the lateral positioning of ROBO1-expressing axons in A. Data are represented as the mean ± SD (one-way ANOVA & Bonferroni post test; animal numbers & p values are indicated; ns, not significant). (C) Anti-ROBO2 staining of transverse sections of E12.5 lumbar spinal cords. The antibodies do not distinguish between isoforms. ROBO2 was primarily expressed by axons in the lateral funiculi, & the overall patterns were comparable between the WT & Nova1/2 dKO embryos. (D) Anti-ROBO1 & anti-ROBO2 staining in the corresponding KO embryos, showing the specificity of the antibodies. The Robo1 KO was generated by trapping the protein product in intracellular compartments (Friedel et al., 2005). ROBO1 expression was seen in neuronal cell bodies but not in axons in Robo1 KO spinal cords, as previously reported (Long et al., 2004). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31392959), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for ROBO2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
Reported in scientific literature (PMID: 34267315)
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Knockout Validated
Reported in scientific literature (PMID: 32220420).
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ROBO2
Long Name
Roundabout Homolog 2
Alternate Names
SAX3
Gene Symbol
ROBO2
Additional ROBO2 Products
Product Documents for ROBO2 Antibody - BSA Free
Product Specific Notices for ROBO2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for ROBO2 Antibody - BSA Free
Customer Reviews for ROBO2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ROBO2 Antibody - BSA Free and earn rewards!
Have you used ROBO2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...