ROR gamma/RORC/NR1F3 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-56610PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
View all ROR gamma/RORC/NR1F3 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ROR gamma/RORC/NR1F3.

Source: E. coli

Amino Acid Sequence: FRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56610.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-56610PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ROR gamma/RORC/NR1F3

ROR gamma/RORC/NR1F3, aka RAR Orphan Receptor gamma, is a Nuclear Receptor 1 Thyroid Hormone-Like receptor containing a short A-T rich sequence follow by a single core motif half-site 5'-AGGTCA-3'. RORC is a key regulator of thymopoiesis, bone metabolism, T-cell apoptosis, and lymphoid organogenesis. NR1F3 regulates intrinsic transcriptional functions. Unlike other major nuclear receptors, RORC binds as a monomer to hormone response elements and is documented in mouse thymus, adipose, bone, skeletal muscle, liver, kidney, and human skeletal muscle. An N-terminal isoform of ROR gamma, ROR gamma T, inhibits Fas ligand expression and cytokine secretion in immature thymocytes.

Long Name

Retinoic Acid-Related Orphan Receptor gamma

Alternate Names

NR1F3, RORC, RZRG

Gene Symbol

RORC

Additional ROR gamma/RORC/NR1F3 Products

Product Documents for ROR gamma/RORC/NR1F3 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ROR gamma/RORC/NR1F3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for ROR gamma/RORC/NR1F3 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review ROR gamma/RORC/NR1F3 Recombinant Protein Antigen and earn rewards!

Have you used ROR gamma/RORC/NR1F3 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for ROR gamma/RORC/NR1F3 Recombinant Protein Antigen

Showing  1 - 2 of 2 FAQs Showing All

  • Q: Does ROR gamma/RORC/NR1F3 antibodies comes in lyophilized form?

    A: Yes, we have 3 RORC antibodies delivere in lyophilized form: MAB61091, MAB61092, MAB6109.

  • Q: What the theoretical molecular weight for ROR gamma/RORC/NR1F3 antibodies?

    A: The TMW of ROR gamma/RORC/NR1F3 antibodies is approximately 56 - 60.

  • Q: Does ROR gamma/RORC/NR1F3 antibodies comes in lyophilized form?

    A: Yes, we have 3 RORC antibodies delivere in lyophilized form: MAB61091, MAB61092, MAB6109.

  • Q: What the theoretical molecular weight for ROR gamma/RORC/NR1F3 antibodies?

    A: The TMW of ROR gamma/RORC/NR1F3 antibodies is approximately 56 - 60.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Proteins and Enzymes