Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (90%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: WKYNEFYHVKTSCSQGPAYVCNITNLQPYTSYNVRVVVVYKTGENSTSLPESFKTKAGVPNKPGIPKLLEGSKNSIQWEKAEDNGC
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (87%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit ROS Antibody - BSA Free (NBP2-13245) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for ROS Antibody - BSA Free
Immunohistochemistry-Paraffin: ROS Antibody [NBP2-13245]
Immunohistochemistry-Paraffin: ROS Antibody [NBP2-13245] - Staining ROS1 in human ovarian cancer tissue.Image submitted by a verified customer review.Immunohistochemistry-Paraffin: ROS Antibody [NBP2-13245]
Immunohistochemistry-Paraffin: ROS Antibody [NBP2-13245] Staining of human kidney shows moderate membranous positivity in cells in glomeruli.Applications for ROS Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ROS antibody validated for IHC-P from a verified customer review.
Reviewed Applications
Read 1 review rated 4 using NBP2-13245 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ROS1
Long Name
ROS Proto-Oncogene 1, Receptor Tyrosine Kinase
Alternate Names
c-Ros-1, MCF3
Gene Symbol
ROS1
Additional ROS1 Products
Product Documents for ROS Antibody - BSA Free
Product Specific Notices for ROS Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for ROS Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used ROS Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Immunohistochemistry-ParaffinSample Tested: Ovarian cancer tissue sampleSpecies: HumanVerified Customer | Posted 12/17/2018NBP2-13245 staining ROS1 in human ovarian cancer tissue sample by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)Perform HIER for 20mins Incubation at 4 ℃ overnight
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...