RPL15 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86782

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RPL15 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of RPL15. Peptide sequence: SALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RPL15 Antibody - BSA Free

Western Blot: RPL15 Antibody [NBP2-86782]

Western Blot: RPL15 Antibody [NBP2-86782]

Western Blot: RPL15 Antibody [NBP2-86782] - WB Suggested Anti-RPL15 Antibody. Titration: 1.0 ug/ml. Positive Control: HepG2 Whole Cell

Applications for RPL15 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPL15

RPL15, also known as Ribosomal Protein L15 or RPL10, has a 204 amino acid long isoform that is 24kDa, and a shorter 145 amino acid long isoform that is approximately 17kDa. RPL15 is a cytoplasmic protein that is component of the large 60S subunit of the ribosome. In some esophageal tumors, RPL15 has been found to be overexpressed. Current research on RPL14 has shown possible links with esophageal cancer, thyroid cancer, Diamond-Blackfan anemia and gastric cancer. RPL15 has also been shown to interact with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D and HIST1H4E.

Alternate Names

60S ribosomal protein L15, EC45MGC88603, FLJ26304, ribosomal protein L15, RPL10, RPLY10, RPYL10

Gene Symbol

RPL15

Additional RPL15 Products

Product Documents for RPL15 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPL15 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPL15 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPL15 Antibody - BSA Free and earn rewards!

Have you used RPL15 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies