RPL18A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88187

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RPL18A Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPL18A. Peptide sequence: IMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RPL18A Antibody - BSA Free

Western Blot: RPL18A Antibody [NBP2-88187]

Western Blot: RPL18A Antibody [NBP2-88187]

Western Blot: RPL18A Antibody [NBP2-88187] - Host: Rabbit. Target Name: RPL18A. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for RPL18A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPL18A

RPL18A, also referred to as 60S Ribosomal Protein L18A, is a component of the large 60S subunit of ribosomes. RPL18A is 176 amino acids in length and is approximately 20kDa. RPL18A has a high binding affinity for Importin 9, a nuclear transport receptor that averts aggregation of RPS7 and RPL18A in the cytoplasm. Current research on RPL18A has shown a possible link with hepatitis C, malaria and Treacher Collins syndrome. RPL18A has also been shown to interact with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D and HIST1H4E.

Alternate Names

60S ribosomal protein L18a, ribosomal protein L18a, ribosomal protein L18a-like protein

Gene Symbol

RPL18A

Additional RPL18A Products

Product Documents for RPL18A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPL18A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPL18A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPL18A Antibody - BSA Free and earn rewards!

Have you used RPL18A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies