RPS23 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-30412

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RPS23 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: CRGLRTARKLRSHRRDQKWHDKQYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RPS23 Antibody - BSA Free

Western Blot: RPS23 Antibody [NBP2-30412]

Western Blot: RPS23 Antibody [NBP2-30412]

Western Blot: RPS23 Antibody [NBP2-30412] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HEK 293
Immunocytochemistry/ Immunofluorescence: RPS23 Antibody [NBP2-30412]

Immunocytochemistry/ Immunofluorescence: RPS23 Antibody [NBP2-30412]

Immunocytochemistry/Immunofluorescence: RPS23 Antibody [NBP2-30412] - Immunofluorescent staining of human cell line MCF7 shows localization to cytosol & endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RPS23 Antibody [NBP2-30412]

Immunohistochemistry-Paraffin: RPS23 Antibody [NBP2-30412]

Immunohistochemistry-Paraffin: RPS23 Antibody [NBP2-30412] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: RPS23 Antibody [NBP2-30412]

Immunohistochemistry-Paraffin: RPS23 Antibody [NBP2-30412]

Immunohistochemistry-Paraffin: RPS23 Antibody [NBP2-30412] - Staining of human lymph node shows moderate cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: RPS23 Antibody [NBP2-30412]

Immunohistochemistry-Paraffin: RPS23 Antibody [NBP2-30412]

Immunohistochemistry-Paraffin: RPS23 Antibody [NBP2-30412] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: RPS23 Antibody [NBP2-30412]

Immunohistochemistry-Paraffin: RPS23 Antibody [NBP2-30412]

Immunohistochemistry-Paraffin: RPS23 Antibody [NBP2-30412] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Applications for RPS23 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPS23

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S12P family of ribosomal proteins. It is located in the cytoplasm. The protein shares significant amino acid similarity with S. cerevisiae ribosomal protein S28. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Alternate Names

FLJ35016, homolog of yeast ribosomal protein S28, ribosomal protein S23,40S ribosomal protein S23

Gene Symbol

RPS23

UniProt

P62266 (Human)

Additional RPS23 Products

Product Documents for RPS23 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RPS23 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPS23 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPS23 Antibody - BSA Free and earn rewards!

Have you used RPS23 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies