RPS25 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93936

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human RPS25 (NP_001019.1). FDKATYDKLCKEVPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RPS25 Antibody - Azide and BSA Free

Western Blot: RPS25 AntibodyAzide and BSA Free [NBP2-93936]

Western Blot: RPS25 AntibodyAzide and BSA Free [NBP2-93936]

Western Blot: RPS25 Antibody [NBP2-93936] - Analysis of extracts of various cell lines, using RPS25 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 15s.
Immunocytochemistry/ Immunofluorescence: RPS25 Antibody - Azide and BSA Free [NBP2-93936]

Immunocytochemistry/ Immunofluorescence: RPS25 Antibody - Azide and BSA Free [NBP2-93936]

Immunocytochemistry/Immunofluorescence: RPS25 Antibody [NBP2-93936] - Analysis of U-2 OS cells using RPS25 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: RPS25 Antibody - Azide and BSA Free [NBP2-93936]

Immunocytochemistry/ Immunofluorescence: RPS25 Antibody - Azide and BSA Free [NBP2-93936]

Immunocytochemistry/Immunofluorescence: RPS25 Antibody [NBP2-93936] - Analysis of L929 cells using RPS25 at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for RPS25 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:200-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RPS25

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S25E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. (provided by RefSeq)

Alternate Names

ribosomal protein S25,40S ribosomal protein S25

Gene Symbol

RPS25

Additional RPS25 Products

Product Documents for RPS25 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPS25 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for RPS25 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review RPS25 Antibody - Azide and BSA Free and earn rewards!

Have you used RPS25 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...