RQCD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83475

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RQCD1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human RQCD1. Peptide sequence: SLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RQCD1 Antibody - BSA Free

Western Blot: RQCD1 Antibody [NBP2-83475]

Western Blot: RQCD1 Antibody [NBP2-83475]

Western Blot: RQCD1 Antibody [NBP2-83475] - Host: Rabbit. Target Name: RQCD1. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/mlRQCD1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Applications for RQCD1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RQCD1

Transcription factor that down-regulates MYB- and JUN-dependent transcription. May play a role in cell differentiation. Can bind oligonucleotides, such as poly-G, poly-C or poly-T (in vitro), but the physiological relevance of this is not certain. Does not bind poly-A

Alternate Names

cancer/testis antigen 129, CNOT9protein involved in sexual development, CT129, rcd-1, rcd1 (required for cell differentiation, S.pombe) homolog 1, RCD1 required for cell differentiation1 homolog (S. pombe), RCD1+, RCD1cell differentiation protein RCD1 homolog

Gene Symbol

CNOT9

Additional RQCD1 Products

Product Documents for RQCD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RQCD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RQCD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RQCD1 Antibody - BSA Free and earn rewards!

Have you used RQCD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies