RWDD3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86787

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RWDD3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of RWDD3. Peptide sequence: ESLLSEPMVHELVLWIQQNLRHILSQPETGSGSEKCTFSTSTTMDDGLWI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RWDD3 Antibody - BSA Free

Western Blot: RWDD3 Antibody [NBP2-86787]

Western Blot: RWDD3 Antibody [NBP2-86787]

Western Blot: RWDD3 Antibody [NBP2-86787] - WB Suggested Anti-RWDD3 Antibody. Titration: 1.0 ug/ml. Positive Control: 293T Whole CellRWDD3 is supported by BioGPS gene expression data to be expressed in HEK293T
Western Blot: RWDD3 Antibody [NBP2-86787]

Western Blot: RWDD3 Antibody [NBP2-86787]

Western Blot: RWDD3 Antibody [NBP2-86787] - Host: Rabbit. Target: RWDD3. Positive control (+): Human kidney (KI). Negative control (-): 293T (2T). Antibody concentration: 1ug/ml

Applications for RWDD3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RWDD3

Enhances the sumoylation of a number of proteins including HIF1A, PIAS and I-kappa-B, through direct interaction with UBC9. Has no effect on ubiquitination

Alternate Names

DKFZP566K023, FLJ51225, RSUME, RWD domain containing 3, RWD domain-containing protein 3, RWD-containing sumoylation enhancer

Gene Symbol

RWDD3

Additional RWDD3 Products

Product Documents for RWDD3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RWDD3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RWDD3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RWDD3 Antibody - BSA Free and earn rewards!

Have you used RWDD3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies