SAR1B Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10007

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SAR1B (NP_001028675.1). Peptide sequence RPEAISEERLREMFGLYGQTTGKGSISLKELNARPLEVFMCSVLKRQGYG

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SAR1B Antibody - BSA Free

Western Blot: SAR1B Antibody [NBP3-10007]

Western Blot: SAR1B Antibody [NBP3-10007]

Western Blot: SAR1B Antibody [NBP3-10007] - Western blot analysis of SAR1B in Human ACHN Whole Cell. Antibody dilution at 1.0ug/ml

Applications for SAR1B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SAR1B

SAR1B belongs to the small GTPase superfamily, SAR1 family. It is involved in transport from the endoplasmic reticulum to the Golgi apparatus and is activated by the guanine nucleotide exchange factor PREB. SAR1B is involved in the selection of the protein cargo and the assembly of the COPII coat complex. Defects in SAR1B are the cause of chylomicron retention disease (CMRD). CMRD is an autosomal recessive disorder of severe fat malabsorption associated with failure to thrive in infancy. The conditions are characterized by deficiency of fat-soluble vitamins, low blood cholesterol levels, and a selective absence of chylomicrons from blood. Affected individuals accumulate chylomicron-like particles in membrane-bound compartments of enterocytes, which contain large cytosolic lipid droplets.

Alternate Names

2310075M17Rik, ANDD, CMRD, EC 3.6.5, GTP-binding protein B, GTP-binding protein SAR1b, GTP-binding protein Sara, SAR1 homolog B (S. cerevisiae), SAR1a gene homolog (S. cerevisiae) 2, SAR1a gene homolog 2, SAR1a gene homolog 2 (S. cerevisiae), SARA2GTBPB, SARB

Gene Symbol

SAR1B

Additional SAR1B Products

Product Documents for SAR1B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SAR1B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SAR1B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SAR1B Antibody - BSA Free and earn rewards!

Have you used SAR1B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...